Vergelijking
Calcitonin (Lachs) vs. FOXO4-DRI
Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.
Identiteit
Categorie
Onderzoek (overig)
Onderzoek (overig)
CAS-nr.
47931-85-1
2074706-72-8
Molecuulmassa
3431.85 g/mol
3735 g/mol
Halfwaardetijd
1 h
0.5 h
Sequentie
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Werkingsmechanisme
Calcitonin (Lachs)
Salmon calcitonin binds the calcitonin receptor, which is particularly densely expressed on bone-resorbing osteoclasts. The literature describes that receptor activation inhibits osteoclast activity and motility, thereby reducing bone resorption. This results in reduced release of calcium and phosphate from bone into the blood, which is regarded as the mechanistic basis for the calcium-lowering effect. The salmon variant binds the receptor more strongly and for longer than human calcitonin, which explains its higher potency. Central nervous system mechanisms are additionally discussed in relation to its pain effect in fractures, the basis of which is regarded in the literature as not fully elucidated.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Bewijsbasis
Hoogste bewijs
Humane RCT
Diermodel
Studies
4
3
waarvan bij mensen
4
0
Geregistreerde effecten
4
3
Openstaande tegenstrijdigheden
1
1
Gedocumenteerde bijwerkingen
2
1
Juridische status
Volledige vermeldingen
Frequently asked questions
- What is the difference between Calcitonin (Lachs) and FOXO4-DRI?
- Calcitonin (Lachs) is classified as "Onderzoek (overig)", while FOXO4-DRI is classified as "Onderzoek (overig)". Calcitonin (Lachs): Salmon calcitonin is a synthetically produced 32-amino-acid peptide hormone that corresponds to the body's own calcitonin but exhibits higher biological potency than the human hormone. In the scientific literature it is studied in the context of inhibiting osteoclast-mediated bone resorption and lowering elevated calcium levels. It was historically broadly approved for the treatment of postmenopausal osteoporosis; following European safety reviews, however, its use was restricted. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Calcitonin (Lachs) or FOXO4-DRI?
- The highest available evidence level is "Humane RCT" for Calcitonin (Lachs) and "Diermodel" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Calcitonin (Lachs) and FOXO4-DRI in Germany and the United States?
- Duitsland: Calcitonin (Lachs) — Op recept, FOXO4-DRI — Alleen onderzoek. Verenigde Staten: Calcitonin (Lachs) — Op recept, FOXO4-DRI — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.