Vergelijking

Liraglutide vs. VK2735

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

204656-20-2

geen gegevens

Molecuulmassa

3751 g/mol

geen gegevens

Halfwaardetijd

13 h

geen gegevens

Sequentie

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

geen gegevens

Werkingsmechanisme

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Liraglutide	VK2735
Duitsland	Op recept	Niet goedgekeurd
Verenigde Staten	Op recept	Niet goedgekeurd

Volledige vermeldingen

Liraglutide

Volledige vermelding →

VK2735

Volledige vermelding →

Frequently asked questions

What is the difference between Liraglutide and VK2735?: Liraglutide is classified as "Metabool", while VK2735 is classified as "Metabool". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or VK2735?: The highest available evidence level is "Humane RCT" for Liraglutide and "Humane RCT" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and VK2735 in Germany and the United States?: Duitsland: Liraglutide — Op recept, VK2735 — Niet goedgekeurd. Verenigde Staten: Liraglutide — Op recept, VK2735 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

VK2735

Duitsland

Op recept

Niet goedgekeurd

Verenigde Staten

Op recept

Niet goedgekeurd

Frequently asked questions

What is the difference between Liraglutide and VK2735?

Liraglutide is classified as "Metabool", while VK2735 is classified as "Metabool". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or VK2735?

The highest available evidence level is "Humane RCT" for Liraglutide and "Humane RCT" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and VK2735 in Germany and the United States?

Duitsland: Liraglutide — Op recept, VK2735 — Niet goedgekeurd. Verenigde Staten: Liraglutide — Op recept, VK2735 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.