Vergelijking

Lixisenatide vs. Semaglutid

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

320367-13-3

910463-68-2

Molecuulmassa

4858.5 g/mol

4113.6 g/mol

Halfwaardetijd

3 h

165 h

Sequentie

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

modifiziertes GLP-1-Analogon (31 AS) mit C18-Fettsäure-Linker

Werkingsmechanisme

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Semaglutid

Long-acting agonist at the GLP-1 receptor. Structurally a modified glucagon-like peptide 1 whose long half-life is achieved via a fatty-acid side chain and reversible albumin binding. Acts centrally on satiety and peripherally on glucose-dependent insulin secretion and delayed gastric emptying.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Lixisenatide	Semaglutid
Zwitserland	—	Op recept
Duitsland	Op recept	Op recept
JP	Op recept	—
Verenigde Staten	Niet goedgekeurd	Op recept

Volledige vermeldingen

Lixisenatide

Volledige vermelding →

Semaglutid

Volledige vermelding →

Frequently asked questions

What is the difference between Lixisenatide and Semaglutid?: Lixisenatide is classified as "Metabool", while Semaglutid is classified as "Metabool". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Lixisenatide or Semaglutid?: The highest available evidence level is "Humane RCT" for Lixisenatide and "Humane RCT" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Lixisenatide and Semaglutid in Germany and the United States?: Duitsland: Lixisenatide — Op recept, Semaglutid — Op recept. Verenigde Staten: Lixisenatide — Niet goedgekeurd, Semaglutid — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Lixisenatide

Semaglutid

Zwitserland

—

Op recept

Duitsland

Op recept

—

Verenigde Staten

Niet goedgekeurd

Op recept

Frequently asked questions

What is the difference between Lixisenatide and Semaglutid?

Lixisenatide is classified as "Metabool", while Semaglutid is classified as "Metabool". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Lixisenatide or Semaglutid?

The highest available evidence level is "Humane RCT" for Lixisenatide and "Humane RCT" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Lixisenatide and Semaglutid in Germany and the United States?

Duitsland: Lixisenatide — Op recept, Semaglutid — Op recept. Verenigde Staten: Lixisenatide — Niet goedgekeurd, Semaglutid — Op recept. These are factual summaries with source and review date on the individual pages.