Сравнение

Amycretin vs. Exenatide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

нет данных

141758-74-9

Молекулярная масса

нет данных

4186.6 g/mol

Период полувыведения

нет данных

2.4 h

Последовательность

нет данных

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Механизм действия

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Amycretin	Exenatide
Германия	Не одобрено	Рецептурный
США	Не одобрено	Рецептурный

Полные записи

Frequently asked questions

What is the difference between Amycretin and Exenatide?: Amycretin is classified as "Метаболизм", while Exenatide is classified as "Метаболизм". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Exenatide?: The highest available evidence level is "РКИ на людях" for Amycretin and "РКИ на людях" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Exenatide in Germany and the United States?: Германия: Amycretin — Не одобрено, Exenatide — Рецептурный. США: Amycretin — Не одобрено, Exenatide — Рецептурный. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Exenatide

Германия

Не одобрено

Рецептурный

США

Не одобрено

Рецептурный

Frequently asked questions

What is the difference between Amycretin and Exenatide?

Amycretin is classified as "Метаболизм", while Exenatide is classified as "Метаболизм". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Exenatide?

The highest available evidence level is "РКИ на людях" for Amycretin and "РКИ на людях" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Exenatide in Germany and the United States?

Германия: Amycretin — Не одобрено, Exenatide — Рецептурный. США: Amycretin — Не одобрено, Exenatide — Рецептурный. These are factual summaries with source and review date on the individual pages.