Vergelijking

Amycretin vs. Exenatide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

geen gegevens

141758-74-9

Molecuulmassa

geen gegevens

4186.6 g/mol

Halfwaardetijd

geen gegevens

2.4 h

Sequentie

geen gegevens

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Werkingsmechanisme

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Amycretin	Exenatide
Duitsland	Niet goedgekeurd	Op recept
Verenigde Staten	Niet goedgekeurd	Op recept

Volledige vermeldingen

Amycretin

Volledige vermelding →

Exenatide

Volledige vermelding →

Frequently asked questions

What is the difference between Amycretin and Exenatide?: Amycretin is classified as "Metabool", while Exenatide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Exenatide?: The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Exenatide in Germany and the United States?: Duitsland: Amycretin — Niet goedgekeurd, Exenatide — Op recept. Verenigde Staten: Amycretin — Niet goedgekeurd, Exenatide — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Exenatide

Duitsland

Niet goedgekeurd

Op recept

Verenigde Staten

Niet goedgekeurd

Op recept

Frequently asked questions

What is the difference between Amycretin and Exenatide?

Amycretin is classified as "Metabool", while Exenatide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Exenatide?

The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Exenatide in Germany and the United States?

Duitsland: Amycretin — Niet goedgekeurd, Exenatide — Op recept. Verenigde Staten: Amycretin — Niet goedgekeurd, Exenatide — Op recept. These are factual summaries with source and review date on the individual pages.