Сравнение

Cagrilintide vs. VK2735

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

1415456-99-3

нет данных

Молекулярная масса

4253.7 g/mol

нет данных

Период полувыведения

168 h

нет данных

Последовательность

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

нет данных

Механизм действия

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Cagrilintide	VK2735
Германия	Не одобрено	Не одобрено
DK	Не одобрено	—
США	Не одобрено	Не одобрено

Полные записи

Frequently asked questions

What is the difference between Cagrilintide and VK2735?: Cagrilintide is classified as "Метаболизм", while VK2735 is classified as "Метаболизм". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or VK2735?: The highest available evidence level is "РКИ на людях" for Cagrilintide and "РКИ на людях" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and VK2735 in Germany and the United States?: Германия: Cagrilintide — Не одобрено, VK2735 — Не одобрено. США: Cagrilintide — Не одобрено, VK2735 — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

VK2735

Германия

Не одобрено

—

США

Не одобрено

Frequently asked questions

What is the difference between Cagrilintide and VK2735?

Cagrilintide is classified as "Метаболизм", while VK2735 is classified as "Метаболизм". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or VK2735?

The highest available evidence level is "РКИ на людях" for Cagrilintide and "РКИ на людях" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and VK2735 in Germany and the United States?

Германия: Cagrilintide — Не одобрено, VK2735 — Не одобрено. США: Cagrilintide — Не одобрено, VK2735 — Не одобрено. These are factual summaries with source and review date on the individual pages.