Vergelijking

Cagrilintide vs. VK2735

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

1415456-99-3

geen gegevens

Molecuulmassa

4253.7 g/mol

geen gegevens

Halfwaardetijd

168 h

geen gegevens

Sequentie

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

geen gegevens

Werkingsmechanisme

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Cagrilintide	VK2735
Duitsland	Niet goedgekeurd	Niet goedgekeurd
DK	Niet goedgekeurd	—
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

Cagrilintide

Volledige vermelding →

VK2735

Volledige vermelding →

Frequently asked questions

What is the difference between Cagrilintide and VK2735?: Cagrilintide is classified as "Metabool", while VK2735 is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or VK2735?: The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and VK2735 in Germany and the United States?: Duitsland: Cagrilintide — Niet goedgekeurd, VK2735 — Niet goedgekeurd. Verenigde Staten: Cagrilintide — Niet goedgekeurd, VK2735 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

VK2735

Duitsland

Niet goedgekeurd

—

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between Cagrilintide and VK2735?

Cagrilintide is classified as "Metabool", while VK2735 is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or VK2735?

The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and VK2735 in Germany and the United States?

Duitsland: Cagrilintide — Niet goedgekeurd, VK2735 — Niet goedgekeurd. Verenigde Staten: Cagrilintide — Niet goedgekeurd, VK2735 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.