Сравнение

CJC-1295 vs. GHRP-2

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Рост

Номер CAS

нет данных

158861-67-7

Молекулярная масса

3647.3 g/mol

817.93 g/mol

Период полувыведения

144 h

0.5 h

Последовательность

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

D-Ala-D-2-Naphthyl-Ala-Ala-Trp-D-Phe-Lys-NH2

Механизм действия

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

GHRP-2

GHRP-2 binds with high affinity to the GH secretagogue receptor (GHSR-1a) in the pituitary and hypothalamus. Activation leads to rapid release of pulsatile growth hormone. Unlike GHRH, GHRP-2 acts via a separate pathway and can be combined synergistically with GHRH to elicit maximal GH responses in provocation tests.

Доказательная база

Наивысшая доказательность

Исследование на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	CJC-1295	GHRP-2
Германия	Не одобрено	Не одобрено
JP	—	Рецептурный
США	Только для исследований	Не одобрено

Полные записи

Frequently asked questions

What is the difference between CJC-1295 and GHRP-2?: CJC-1295 is classified as "Рост", while GHRP-2 is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. GHRP-2: Synthetic hexapeptide of the GH secretagogue family. Approved in Japan as GHRP Kaken as a diagnostic test for GH deficiency. Not available as a medicine outside Japan. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or GHRP-2?: The highest available evidence level is "Исследование на людях" for CJC-1295 and "Исследование на людях" for GHRP-2. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and GHRP-2 in Germany and the United States?: Германия: CJC-1295 — Не одобрено, GHRP-2 — Не одобрено. США: CJC-1295 — Только для исследований, GHRP-2 — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

GHRP-2

Германия

Не одобрено

—

Рецептурный

США

Только для исследований

Не одобрено

Frequently asked questions

What is the difference between CJC-1295 and GHRP-2?

CJC-1295 is classified as "Рост", while GHRP-2 is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. GHRP-2: Synthetic hexapeptide of the GH secretagogue family. Approved in Japan as GHRP Kaken as a diagnostic test for GH deficiency. Not available as a medicine outside Japan. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or GHRP-2?

The highest available evidence level is "Исследование на людях" for CJC-1295 and "Исследование на людях" for GHRP-2. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and GHRP-2 in Germany and the United States?

Германия: CJC-1295 — Не одобрено, GHRP-2 — Не одобрено. США: CJC-1295 — Только для исследований, GHRP-2 — Не одобрено. These are factual summaries with source and review date on the individual pages.