Vergelijking

CJC-1295 vs. GHRP-2

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Groei

CAS-nr.

geen gegevens

158861-67-7

Molecuulmassa

3647.3 g/mol

817.93 g/mol

Halfwaardetijd

144 h

0.5 h

Sequentie

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

D-Ala-D-2-Naphthyl-Ala-Ala-Trp-D-Phe-Lys-NH2

Werkingsmechanisme

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

GHRP-2

GHRP-2 binds with high affinity to the GH secretagogue receptor (GHSR-1a) in the pituitary and hypothalamus. Activation leads to rapid release of pulsatile growth hormone. Unlike GHRH, GHRP-2 acts via a separate pathway and can be combined synergistically with GHRH to elicit maximal GH responses in provocation tests.

Bewijsbasis

Hoogste bewijs

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	CJC-1295	GHRP-2
Duitsland	Niet goedgekeurd	Niet goedgekeurd
JP	—	Op recept
Verenigde Staten	Alleen onderzoek	Niet goedgekeurd

Volledige vermeldingen

CJC-1295

Volledige vermelding →

GHRP-2

Volledige vermelding →

Frequently asked questions

What is the difference between CJC-1295 and GHRP-2?: CJC-1295 is classified as "Groei", while GHRP-2 is classified as "Groei". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. GHRP-2: Synthetic hexapeptide of the GH secretagogue family. Approved in Japan as GHRP Kaken as a diagnostic test for GH deficiency. Not available as a medicine outside Japan. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or GHRP-2?: The highest available evidence level is "Humane studie" for CJC-1295 and "Humane studie" for GHRP-2. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and GHRP-2 in Germany and the United States?: Duitsland: CJC-1295 — Niet goedgekeurd, GHRP-2 — Niet goedgekeurd. Verenigde Staten: CJC-1295 — Alleen onderzoek, GHRP-2 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

GHRP-2

Duitsland

Niet goedgekeurd

—

Op recept

Verenigde Staten

Alleen onderzoek

Niet goedgekeurd

Frequently asked questions

What is the difference between CJC-1295 and GHRP-2?

CJC-1295 is classified as "Groei", while GHRP-2 is classified as "Groei". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. GHRP-2: Synthetic hexapeptide of the GH secretagogue family. Approved in Japan as GHRP Kaken as a diagnostic test for GH deficiency. Not available as a medicine outside Japan. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or GHRP-2?

The highest available evidence level is "Humane studie" for CJC-1295 and "Humane studie" for GHRP-2. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and GHRP-2 in Germany and the United States?

Duitsland: CJC-1295 — Niet goedgekeurd, GHRP-2 — Niet goedgekeurd. Verenigde Staten: CJC-1295 — Alleen onderzoek, GHRP-2 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.