Confronto

CJC-1295 vs. GHRP-2

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Crescita

N. CAS

nessun dato

158861-67-7

Peso molecolare

3647.3 g/mol

817.93 g/mol

Emivita

144 h

0.5 h

Sequenza

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

D-Ala-D-2-Naphthyl-Ala-Ala-Trp-D-Phe-Lys-NH2

Meccanismo d'azione

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

GHRP-2

GHRP-2 binds with high affinity to the GH secretagogue receptor (GHSR-1a) in the pituitary and hypothalamus. Activation leads to rapid release of pulsatile growth hormone. Unlike GHRH, GHRP-2 acts via a separate pathway and can be combined synergistically with GHRH to elicit maximal GH responses in provocation tests.

Base di evidenze

Evidenza più alta

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	CJC-1295	GHRP-2
Germania	Non approvato	Non approvato
JP	—	Su prescrizione
Stati Uniti	Solo ricerca	Non approvato

Voci complete

Frequently asked questions

What is the difference between CJC-1295 and GHRP-2?: CJC-1295 is classified as "Crescita", while GHRP-2 is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. GHRP-2: Synthetic hexapeptide of the GH secretagogue family. Approved in Japan as GHRP Kaken as a diagnostic test for GH deficiency. Not available as a medicine outside Japan. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or GHRP-2?: The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "Studio sull'uomo" for GHRP-2. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and GHRP-2 in Germany and the United States?: Germania: CJC-1295 — Non approvato, GHRP-2 — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, GHRP-2 — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

GHRP-2

Germania

Non approvato

—

Su prescrizione

Stati Uniti

Solo ricerca

Non approvato

Frequently asked questions

What is the difference between CJC-1295 and GHRP-2?

CJC-1295 is classified as "Crescita", while GHRP-2 is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. GHRP-2: Synthetic hexapeptide of the GH secretagogue family. Approved in Japan as GHRP Kaken as a diagnostic test for GH deficiency. Not available as a medicine outside Japan. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or GHRP-2?

The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "Studio sull'uomo" for GHRP-2. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and GHRP-2 in Germany and the United States?

Germania: CJC-1295 — Non approvato, GHRP-2 — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, GHRP-2 — Non approvato. These are factual summaries with source and review date on the individual pages.