Сравнение

CJC-1295 vs. Sermorelin

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Рост

Номер CAS

нет данных

86168-78-7

Молекулярная масса

3647.3 g/mol

3358 g/mol

Период полувыведения

144 h

0.2 h

Последовательность

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

YADAIFTNSYRKVLGQLSARKLLQDIMSR

Механизм действия

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Sermorelin

Synthetic analogue of the first 29 amino acids of human growth-hormone-releasing hormone (GHRH). Stimulates pulsatile endogenous growth-hormone secretion from the pituitary via the GHRH receptor. Very short plasma half-life — pharmacodynamic effect lasts several hours nevertheless.

Доказательная база

Наивысшая доказательность

Исследование на людях

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	CJC-1295	Sermorelin
Германия	Не одобрено	Не одобрено
США	Только для исследований	Только для исследований

Полные записи

Frequently asked questions

What is the difference between CJC-1295 and Sermorelin?: CJC-1295 is classified as "Рост", while Sermorelin is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Sermorelin: Synthetic analogue of the first 29 amino acids of human GHRH. Stimulates pulsatile growth-hormone secretion from the pituitary. Formerly FDA-approved as Geref Diagnostic, now withdrawn in many markets — compounding and research use dominate. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Sermorelin?: The highest available evidence level is "Исследование на людях" for CJC-1295 and "РКИ на людях" for Sermorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Sermorelin in Germany and the United States?: Германия: CJC-1295 — Не одобрено, Sermorelin — Не одобрено. США: CJC-1295 — Только для исследований, Sermorelin — Только для исследований. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Sermorelin

Германия

Не одобрено

США

Только для исследований

Frequently asked questions

What is the difference between CJC-1295 and Sermorelin?

CJC-1295 is classified as "Рост", while Sermorelin is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Sermorelin: Synthetic analogue of the first 29 amino acids of human GHRH. Stimulates pulsatile growth-hormone secretion from the pituitary. Formerly FDA-approved as Geref Diagnostic, now withdrawn in many markets — compounding and research use dominate. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Sermorelin?

The highest available evidence level is "Исследование на людях" for CJC-1295 and "РКИ на людях" for Sermorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Sermorelin in Germany and the United States?

Германия: CJC-1295 — Не одобрено, Sermorelin — Не одобрено. США: CJC-1295 — Только для исследований, Sermorelin — Только для исследований. These are factual summaries with source and review date on the individual pages.