Vergelijking

CJC-1295 vs. Sermorelin

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Groei

CAS-nr.

geen gegevens

86168-78-7

Molecuulmassa

3647.3 g/mol

3358 g/mol

Halfwaardetijd

144 h

0.2 h

Sequentie

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

YADAIFTNSYRKVLGQLSARKLLQDIMSR

Werkingsmechanisme

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Sermorelin

Synthetic analogue of the first 29 amino acids of human growth-hormone-releasing hormone (GHRH). Stimulates pulsatile endogenous growth-hormone secretion from the pituitary via the GHRH receptor. Very short plasma half-life — pharmacodynamic effect lasts several hours nevertheless.

Bewijsbasis

Hoogste bewijs

Humane studie

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	CJC-1295	Sermorelin
Duitsland	Niet goedgekeurd	Niet goedgekeurd
Verenigde Staten	Alleen onderzoek	Alleen onderzoek

Volledige vermeldingen

CJC-1295

Volledige vermelding →

Sermorelin

Volledige vermelding →

Frequently asked questions

What is the difference between CJC-1295 and Sermorelin?: CJC-1295 is classified as "Groei", while Sermorelin is classified as "Groei". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Sermorelin: Synthetic analogue of the first 29 amino acids of human GHRH. Stimulates pulsatile growth-hormone secretion from the pituitary. Formerly FDA-approved as Geref Diagnostic, now withdrawn in many markets — compounding and research use dominate. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Sermorelin?: The highest available evidence level is "Humane studie" for CJC-1295 and "Humane RCT" for Sermorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Sermorelin in Germany and the United States?: Duitsland: CJC-1295 — Niet goedgekeurd, Sermorelin — Niet goedgekeurd. Verenigde Staten: CJC-1295 — Alleen onderzoek, Sermorelin — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Sermorelin

Duitsland

Niet goedgekeurd

Verenigde Staten

Alleen onderzoek

Frequently asked questions

What is the difference between CJC-1295 and Sermorelin?

CJC-1295 is classified as "Groei", while Sermorelin is classified as "Groei". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Sermorelin: Synthetic analogue of the first 29 amino acids of human GHRH. Stimulates pulsatile growth-hormone secretion from the pituitary. Formerly FDA-approved as Geref Diagnostic, now withdrawn in many markets — compounding and research use dominate. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Sermorelin?

The highest available evidence level is "Humane studie" for CJC-1295 and "Humane RCT" for Sermorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Sermorelin in Germany and the United States?

Duitsland: CJC-1295 — Niet goedgekeurd, Sermorelin — Niet goedgekeurd. Verenigde Staten: CJC-1295 — Alleen onderzoek, Sermorelin — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.