Confronto

CJC-1295 vs. Sermorelin

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Crescita

N. CAS

nessun dato

86168-78-7

Peso molecolare

3647.3 g/mol

3358 g/mol

Emivita

144 h

0.2 h

Sequenza

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

YADAIFTNSYRKVLGQLSARKLLQDIMSR

Meccanismo d'azione

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Sermorelin

Synthetic analogue of the first 29 amino acids of human growth-hormone-releasing hormone (GHRH). Stimulates pulsatile endogenous growth-hormone secretion from the pituitary via the GHRH receptor. Very short plasma half-life — pharmacodynamic effect lasts several hours nevertheless.

Base di evidenze

Evidenza più alta

Studio sull'uomo

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	CJC-1295	Sermorelin
Germania	Non approvato	Non approvato
Stati Uniti	Solo ricerca	Solo ricerca

Voci complete

Frequently asked questions

What is the difference between CJC-1295 and Sermorelin?: CJC-1295 is classified as "Crescita", while Sermorelin is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Sermorelin: Synthetic analogue of the first 29 amino acids of human GHRH. Stimulates pulsatile growth-hormone secretion from the pituitary. Formerly FDA-approved as Geref Diagnostic, now withdrawn in many markets — compounding and research use dominate. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Sermorelin?: The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "RCT sull'uomo" for Sermorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Sermorelin in Germany and the United States?: Germania: CJC-1295 — Non approvato, Sermorelin — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, Sermorelin — Solo ricerca. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Sermorelin

Germania

Non approvato

Stati Uniti

Solo ricerca

Frequently asked questions

What is the difference between CJC-1295 and Sermorelin?

CJC-1295 is classified as "Crescita", while Sermorelin is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Sermorelin: Synthetic analogue of the first 29 amino acids of human GHRH. Stimulates pulsatile growth-hormone secretion from the pituitary. Formerly FDA-approved as Geref Diagnostic, now withdrawn in many markets — compounding and research use dominate. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Sermorelin?

The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "RCT sull'uomo" for Sermorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Sermorelin in Germany and the United States?

Germania: CJC-1295 — Non approvato, Sermorelin — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, Sermorelin — Solo ricerca. These are factual summaries with source and review date on the individual pages.