Сравнение

Exenatide vs. Maridebart Cafraglutide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

141758-74-9

нет данных

Молекулярная масса

4186.6 g/mol

нет данных

Период полувыведения

2.4 h

нет данных

Последовательность

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

нет данных

Механизм действия

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Exenatide	Maridebart Cafraglutide
Германия	Рецептурный	Не одобрено
США	Рецептурный	Не одобрено

Полные записи

Exenatide

Полная запись →

Maridebart Cafraglutide

Полная запись →

Frequently asked questions

What is the difference between Exenatide and Maridebart Cafraglutide?: Exenatide is classified as "Метаболизм", while Maridebart Cafraglutide is classified as "Метаболизм". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Maridebart Cafraglutide?: The highest available evidence level is "РКИ на людях" for Exenatide and "РКИ на людях" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Maridebart Cafraglutide in Germany and the United States?: Германия: Exenatide — Рецептурный, Maridebart Cafraglutide — Не одобрено. США: Exenatide — Рецептурный, Maridebart Cafraglutide — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Maridebart Cafraglutide

Германия

Рецептурный

Не одобрено

США

Рецептурный

Не одобрено

Frequently asked questions

What is the difference between Exenatide and Maridebart Cafraglutide?

Exenatide is classified as "Метаболизм", while Maridebart Cafraglutide is classified as "Метаболизм". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Maridebart Cafraglutide?

The highest available evidence level is "РКИ на людях" for Exenatide and "РКИ на людях" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Maridebart Cafraglutide in Germany and the United States?

Германия: Exenatide — Рецептурный, Maridebart Cafraglutide — Не одобрено. США: Exenatide — Рецептурный, Maridebart Cafraglutide — Не одобрено. These are factual summaries with source and review date on the individual pages.