Vergelijking

Exenatide vs. Maridebart Cafraglutide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

141758-74-9

geen gegevens

Molecuulmassa

4186.6 g/mol

geen gegevens

Halfwaardetijd

2.4 h

geen gegevens

Sequentie

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

geen gegevens

Werkingsmechanisme

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Exenatide	Maridebart Cafraglutide
Duitsland	Op recept	Niet goedgekeurd
Verenigde Staten	Op recept	Niet goedgekeurd

Volledige vermeldingen

Exenatide

Volledige vermelding →

Maridebart Cafraglutide

Volledige vermelding →

Frequently asked questions

What is the difference between Exenatide and Maridebart Cafraglutide?: Exenatide is classified as "Metabool", while Maridebart Cafraglutide is classified as "Metabool". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Maridebart Cafraglutide?: The highest available evidence level is "Humane RCT" for Exenatide and "Humane RCT" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Maridebart Cafraglutide in Germany and the United States?: Duitsland: Exenatide — Op recept, Maridebart Cafraglutide — Niet goedgekeurd. Verenigde Staten: Exenatide — Op recept, Maridebart Cafraglutide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Maridebart Cafraglutide

Duitsland

Op recept

Niet goedgekeurd

Verenigde Staten

Op recept

Niet goedgekeurd

Frequently asked questions

What is the difference between Exenatide and Maridebart Cafraglutide?

Exenatide is classified as "Metabool", while Maridebart Cafraglutide is classified as "Metabool". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Maridebart Cafraglutide?

The highest available evidence level is "Humane RCT" for Exenatide and "Humane RCT" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Maridebart Cafraglutide in Germany and the United States?

Duitsland: Exenatide — Op recept, Maridebart Cafraglutide — Niet goedgekeurd. Verenigde Staten: Exenatide — Op recept, Maridebart Cafraglutide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.