Сравнение

LL-37 vs. Sincalide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Исследования (прочее)

Номер CAS

597562-32-8

25126-32-3

Молекулярная масса

4493.33 g/mol

1143.29 g/mol

Период полувыведения

нет данных

Последовательность

[LL-37, 37 aa]

Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-Phe-NH2

Механизм действия

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Sincalide

Sincalide activates CCK receptors, triggering gallbladder contraction and pancreatic enzyme secretion. This effect is used diagnostically to measure the gallbladder ejection fraction (e.g. in HIDA scintigraphy).

Доказательная база

Наивысшая доказательность

Исследование на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	LL-37	Sincalide
Германия	Только для исследований	Неясно
США	Только для исследований	Рецептурный

Полные записи

Frequently asked questions

What is the difference between LL-37 and Sincalide?: LL-37 is classified as "Исследования (прочее)", while Sincalide is classified as "Исследования (прочее)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sincalide: Sincalide is the synthetic C-terminal octapeptide of the hormone cholecystokinin (CCK-8). As Kinevac it is FDA-approved to stimulate gallbladder contraction for diagnostic imaging. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, LL-37 or Sincalide?: The highest available evidence level is "Исследование на людях" for LL-37 and "Исследование на людях" for Sincalide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of LL-37 and Sincalide in Germany and the United States?: Германия: LL-37 — Только для исследований, Sincalide — Неясно. США: LL-37 — Только для исследований, Sincalide — Рецептурный. These are factual summaries with source and review date on the individual pages.

Country

LL-37

Sincalide

Германия

Только для исследований

Неясно

США

Только для исследований

Рецептурный

Frequently asked questions

What is the difference between LL-37 and Sincalide?

LL-37 is classified as "Исследования (прочее)", while Sincalide is classified as "Исследования (прочее)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sincalide: Sincalide is the synthetic C-terminal octapeptide of the hormone cholecystokinin (CCK-8). As Kinevac it is FDA-approved to stimulate gallbladder contraction for diagnostic imaging. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, LL-37 or Sincalide?

The highest available evidence level is "Исследование на людях" for LL-37 and "Исследование на людях" for Sincalide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of LL-37 and Sincalide in Germany and the United States?

Германия: LL-37 — Только для исследований, Sincalide — Неясно. США: LL-37 — Только для исследований, Sincalide — Рецептурный. These are factual summaries with source and review date on the individual pages.