Vergelijking

LL-37 vs. Sincalide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Onderzoek (overig)

CAS-nr.

597562-32-8

25126-32-3

Molecuulmassa

4493.33 g/mol

1143.29 g/mol

Halfwaardetijd

geen gegevens

Sequentie

[LL-37, 37 aa]

Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-Phe-NH2

Werkingsmechanisme

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Sincalide

Sincalide activates CCK receptors, triggering gallbladder contraction and pancreatic enzyme secretion. This effect is used diagnostically to measure the gallbladder ejection fraction (e.g. in HIDA scintigraphy).

Bewijsbasis

Hoogste bewijs

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	LL-37	Sincalide
Duitsland	Alleen onderzoek	Onduidelijk
Verenigde Staten	Alleen onderzoek	Op recept

Volledige vermeldingen

LL-37

Volledige vermelding →

Sincalide

Volledige vermelding →

Frequently asked questions

What is the difference between LL-37 and Sincalide?: LL-37 is classified as "Onderzoek (overig)", while Sincalide is classified as "Onderzoek (overig)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sincalide: Sincalide is the synthetic C-terminal octapeptide of the hormone cholecystokinin (CCK-8). As Kinevac it is FDA-approved to stimulate gallbladder contraction for diagnostic imaging. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, LL-37 or Sincalide?: The highest available evidence level is "Humane studie" for LL-37 and "Humane studie" for Sincalide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of LL-37 and Sincalide in Germany and the United States?: Duitsland: LL-37 — Alleen onderzoek, Sincalide — Onduidelijk. Verenigde Staten: LL-37 — Alleen onderzoek, Sincalide — Op recept. These are factual summaries with source and review date on the individual pages.

Country

LL-37

Sincalide

Duitsland

Alleen onderzoek

Onduidelijk

Verenigde Staten

Alleen onderzoek

Op recept

Frequently asked questions

What is the difference between LL-37 and Sincalide?

LL-37 is classified as "Onderzoek (overig)", while Sincalide is classified as "Onderzoek (overig)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sincalide: Sincalide is the synthetic C-terminal octapeptide of the hormone cholecystokinin (CCK-8). As Kinevac it is FDA-approved to stimulate gallbladder contraction for diagnostic imaging. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, LL-37 or Sincalide?

The highest available evidence level is "Humane studie" for LL-37 and "Humane studie" for Sincalide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of LL-37 and Sincalide in Germany and the United States?

Duitsland: LL-37 — Alleen onderzoek, Sincalide — Onduidelijk. Verenigde Staten: LL-37 — Alleen onderzoek, Sincalide — Op recept. These are factual summaries with source and review date on the individual pages.