Confronto

LL-37 vs. Sincalide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Ricerca (altro)

N. CAS

597562-32-8

25126-32-3

Peso molecolare

4493.33 g/mol

1143.29 g/mol

Emivita

nessun dato

Sequenza

[LL-37, 37 aa]

Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-Phe-NH2

Meccanismo d'azione

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Sincalide

Sincalide activates CCK receptors, triggering gallbladder contraction and pancreatic enzyme secretion. This effect is used diagnostically to measure the gallbladder ejection fraction (e.g. in HIDA scintigraphy).

Base di evidenze

Evidenza più alta

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	LL-37	Sincalide
Germania	Solo ricerca	Non chiaro
Stati Uniti	Solo ricerca	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between LL-37 and Sincalide?: LL-37 is classified as "Ricerca (altro)", while Sincalide is classified as "Ricerca (altro)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sincalide: Sincalide is the synthetic C-terminal octapeptide of the hormone cholecystokinin (CCK-8). As Kinevac it is FDA-approved to stimulate gallbladder contraction for diagnostic imaging. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, LL-37 or Sincalide?: The highest available evidence level is "Studio sull'uomo" for LL-37 and "Studio sull'uomo" for Sincalide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of LL-37 and Sincalide in Germany and the United States?: Germania: LL-37 — Solo ricerca, Sincalide — Non chiaro. Stati Uniti: LL-37 — Solo ricerca, Sincalide — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

LL-37

Sincalide

Germania

Solo ricerca

Non chiaro

Stati Uniti

Solo ricerca

Su prescrizione

Frequently asked questions

What is the difference between LL-37 and Sincalide?

LL-37 is classified as "Ricerca (altro)", while Sincalide is classified as "Ricerca (altro)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sincalide: Sincalide is the synthetic C-terminal octapeptide of the hormone cholecystokinin (CCK-8). As Kinevac it is FDA-approved to stimulate gallbladder contraction for diagnostic imaging. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, LL-37 or Sincalide?

The highest available evidence level is "Studio sull'uomo" for LL-37 and "Studio sull'uomo" for Sincalide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of LL-37 and Sincalide in Germany and the United States?

Germania: LL-37 — Solo ricerca, Sincalide — Non chiaro. Stati Uniti: LL-37 — Solo ricerca, Sincalide — Su prescrizione. These are factual summaries with source and review date on the individual pages.