Confronto

Amycretin vs. Cagrilintide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

nessun dato

1415456-99-3

Peso molecolare

nessun dato

4253.7 g/mol

Emivita

nessun dato

168 h

Sequenza

nessun dato

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

Meccanismo d'azione

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Amycretin	Cagrilintide
Germania	Non approvato	Non approvato
DK	—	Non approvato
Stati Uniti	Non approvato	Non approvato

Voci complete

Frequently asked questions

What is the difference between Amycretin and Cagrilintide?: Amycretin is classified as "Metabolico", while Cagrilintide is classified as "Metabolico". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Cagrilintide?: The highest available evidence level is "RCT sull'uomo" for Amycretin and "RCT sull'uomo" for Cagrilintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Cagrilintide in Germany and the United States?: Germania: Amycretin — Non approvato, Cagrilintide — Non approvato. Stati Uniti: Amycretin — Non approvato, Cagrilintide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Cagrilintide

Germania

Non approvato

—

Non approvato

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Amycretin and Cagrilintide?

Amycretin is classified as "Metabolico", while Cagrilintide is classified as "Metabolico". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Cagrilintide?

The highest available evidence level is "RCT sull'uomo" for Amycretin and "RCT sull'uomo" for Cagrilintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Cagrilintide in Germany and the United States?

Germania: Amycretin — Non approvato, Cagrilintide — Non approvato. Stati Uniti: Amycretin — Non approvato, Cagrilintide — Non approvato. These are factual summaries with source and review date on the individual pages.