Vergelijking

Amycretin vs. Cagrilintide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

geen gegevens

1415456-99-3

Molecuulmassa

geen gegevens

4253.7 g/mol

Halfwaardetijd

geen gegevens

168 h

Sequentie

geen gegevens

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

Werkingsmechanisme

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Amycretin	Cagrilintide
Duitsland	Niet goedgekeurd	Niet goedgekeurd
DK	—	Niet goedgekeurd
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

Amycretin

Volledige vermelding →

Cagrilintide

Volledige vermelding →

Frequently asked questions

What is the difference between Amycretin and Cagrilintide?: Amycretin is classified as "Metabool", while Cagrilintide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Cagrilintide?: The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Cagrilintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Cagrilintide in Germany and the United States?: Duitsland: Amycretin — Niet goedgekeurd, Cagrilintide — Niet goedgekeurd. Verenigde Staten: Amycretin — Niet goedgekeurd, Cagrilintide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Cagrilintide

Duitsland

Niet goedgekeurd

—

Niet goedgekeurd

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between Amycretin and Cagrilintide?

Amycretin is classified as "Metabool", while Cagrilintide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Cagrilintide?

The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Cagrilintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Cagrilintide in Germany and the United States?

Duitsland: Amycretin — Niet goedgekeurd, Cagrilintide — Niet goedgekeurd. Verenigde Staten: Amycretin — Niet goedgekeurd, Cagrilintide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.