Confronto

Cagrilintide vs. Maridebart Cafraglutide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

1415456-99-3

nessun dato

Peso molecolare

4253.7 g/mol

nessun dato

Emivita

168 h

nessun dato

Sequenza

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

nessun dato

Meccanismo d'azione

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Cagrilintide	Maridebart Cafraglutide
Germania	Non approvato	Non approvato
DK	Non approvato	—
Stati Uniti	Non approvato	Non approvato

Voci complete

Cagrilintide

Voce completa →

Maridebart Cafraglutide

Voce completa →

Frequently asked questions

What is the difference between Cagrilintide and Maridebart Cafraglutide?: Cagrilintide is classified as "Metabolico", while Maridebart Cafraglutide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Maridebart Cafraglutide?: The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Maridebart Cafraglutide in Germany and the United States?: Germania: Cagrilintide — Non approvato, Maridebart Cafraglutide — Non approvato. Stati Uniti: Cagrilintide — Non approvato, Maridebart Cafraglutide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Maridebart Cafraglutide

Germania

Non approvato

—

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Cagrilintide and Maridebart Cafraglutide?

Cagrilintide is classified as "Metabolico", while Maridebart Cafraglutide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Maridebart Cafraglutide?

The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Maridebart Cafraglutide in Germany and the United States?

Germania: Cagrilintide — Non approvato, Maridebart Cafraglutide — Non approvato. Stati Uniti: Cagrilintide — Non approvato, Maridebart Cafraglutide — Non approvato. These are factual summaries with source and review date on the individual pages.