Vergelijking

Cagrilintide vs. Maridebart Cafraglutide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

1415456-99-3

geen gegevens

Molecuulmassa

4253.7 g/mol

geen gegevens

Halfwaardetijd

168 h

geen gegevens

Sequentie

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

geen gegevens

Werkingsmechanisme

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Cagrilintide	Maridebart Cafraglutide
Duitsland	Niet goedgekeurd	Niet goedgekeurd
DK	Niet goedgekeurd	—
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

Cagrilintide

Volledige vermelding →

Maridebart Cafraglutide

Volledige vermelding →

Frequently asked questions

What is the difference between Cagrilintide and Maridebart Cafraglutide?: Cagrilintide is classified as "Metabool", while Maridebart Cafraglutide is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Maridebart Cafraglutide?: The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Maridebart Cafraglutide in Germany and the United States?: Duitsland: Cagrilintide — Niet goedgekeurd, Maridebart Cafraglutide — Niet goedgekeurd. Verenigde Staten: Cagrilintide — Niet goedgekeurd, Maridebart Cafraglutide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Maridebart Cafraglutide

Duitsland

Niet goedgekeurd

—

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between Cagrilintide and Maridebart Cafraglutide?

Cagrilintide is classified as "Metabool", while Maridebart Cafraglutide is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Maridebart Cafraglutide?

The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Maridebart Cafraglutide in Germany and the United States?

Duitsland: Cagrilintide — Niet goedgekeurd, Maridebart Cafraglutide — Niet goedgekeurd. Verenigde Staten: Cagrilintide — Niet goedgekeurd, Maridebart Cafraglutide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.