Confronto

Cagrilintide vs. Mazdutide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

1415456-99-3

2259884-03-0

Peso molecolare

4253.7 g/mol

4790 g/mol

Emivita

168 h

132 h

Sequenza

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

synthetisches Oxyntomodulin-Analogon (39 Aminosäuren) mit Fettsäureseitenkette

Meccanismo d'azione

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Mazdutide

Mazdutide is a dual agonist at the GLP-1 and glucagon receptors and is structurally derived from the gut hormone oxyntomodulin. The GLP-1 component mediates glucose-dependent insulin secretion, inhibition of glucagon secretion at elevated blood glucose, and modulation of appetite and gastric emptying. The glucagon component can influence energy expenditure and hepatic lipid and glucose metabolism. A fatty-acid side chain enables albumin binding and the weekly administration interval.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Cagrilintide	Mazdutide
CN	—	Su prescrizione
Germania	Non approvato	Solo ricerca
DK	Non approvato	—
Stati Uniti	Non approvato	Solo ricerca

Voci complete

Frequently asked questions

What is the difference between Cagrilintide and Mazdutide?: Cagrilintide is classified as "Metabolico", while Mazdutide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Mazdutide: Synthetic oxyntomodulin analogue that simultaneously activates the GLP-1 and glucagon receptors (dual agonist). Developed by Innovent Biologics and Eli Lilly. In China the NMPA approved mazdutide on 27 June 2025 for chronic weight management; a further filing for type 2 diabetes is under review in China. Outside China the substance remains in clinical development. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Mazdutide?: The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Mazdutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Mazdutide in Germany and the United States?: Germania: Cagrilintide — Non approvato, Mazdutide — Solo ricerca. Stati Uniti: Cagrilintide — Non approvato, Mazdutide — Solo ricerca. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Mazdutide

—

Su prescrizione

Germania

Non approvato

Solo ricerca

Non approvato

—

Stati Uniti

Non approvato

Solo ricerca

Frequently asked questions

What is the difference between Cagrilintide and Mazdutide?

Cagrilintide is classified as "Metabolico", while Mazdutide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Mazdutide: Synthetic oxyntomodulin analogue that simultaneously activates the GLP-1 and glucagon receptors (dual agonist). Developed by Innovent Biologics and Eli Lilly. In China the NMPA approved mazdutide on 27 June 2025 for chronic weight management; a further filing for type 2 diabetes is under review in China. Outside China the substance remains in clinical development. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Mazdutide?

The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Mazdutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Mazdutide in Germany and the United States?

Germania: Cagrilintide — Non approvato, Mazdutide — Solo ricerca. Stati Uniti: Cagrilintide — Non approvato, Mazdutide — Solo ricerca. These are factual summaries with source and review date on the individual pages.