Vergelijking

Cagrilintide vs. Mazdutide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

1415456-99-3

2259884-03-0

Molecuulmassa

4253.7 g/mol

4790 g/mol

Halfwaardetijd

168 h

132 h

Sequentie

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

synthetisches Oxyntomodulin-Analogon (39 Aminosäuren) mit Fettsäureseitenkette

Werkingsmechanisme

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Mazdutide

Mazdutide is a dual agonist at the GLP-1 and glucagon receptors and is structurally derived from the gut hormone oxyntomodulin. The GLP-1 component mediates glucose-dependent insulin secretion, inhibition of glucagon secretion at elevated blood glucose, and modulation of appetite and gastric emptying. The glucagon component can influence energy expenditure and hepatic lipid and glucose metabolism. A fatty-acid side chain enables albumin binding and the weekly administration interval.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Cagrilintide	Mazdutide
CN	—	Op recept
Duitsland	Niet goedgekeurd	Alleen onderzoek
DK	Niet goedgekeurd	—
Verenigde Staten	Niet goedgekeurd	Alleen onderzoek

Volledige vermeldingen

Cagrilintide

Volledige vermelding →

Mazdutide

Volledige vermelding →

Frequently asked questions

What is the difference between Cagrilintide and Mazdutide?: Cagrilintide is classified as "Metabool", while Mazdutide is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Mazdutide: Synthetic oxyntomodulin analogue that simultaneously activates the GLP-1 and glucagon receptors (dual agonist). Developed by Innovent Biologics and Eli Lilly. In China the NMPA approved mazdutide on 27 June 2025 for chronic weight management; a further filing for type 2 diabetes is under review in China. Outside China the substance remains in clinical development. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Mazdutide?: The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for Mazdutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Mazdutide in Germany and the United States?: Duitsland: Cagrilintide — Niet goedgekeurd, Mazdutide — Alleen onderzoek. Verenigde Staten: Cagrilintide — Niet goedgekeurd, Mazdutide — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Mazdutide

—

Op recept

Duitsland

Niet goedgekeurd

Alleen onderzoek

Niet goedgekeurd

—

Verenigde Staten

Niet goedgekeurd

Alleen onderzoek

Frequently asked questions

What is the difference between Cagrilintide and Mazdutide?

Cagrilintide is classified as "Metabool", while Mazdutide is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Mazdutide: Synthetic oxyntomodulin analogue that simultaneously activates the GLP-1 and glucagon receptors (dual agonist). Developed by Innovent Biologics and Eli Lilly. In China the NMPA approved mazdutide on 27 June 2025 for chronic weight management; a further filing for type 2 diabetes is under review in China. Outside China the substance remains in clinical development. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Mazdutide?

The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for Mazdutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Mazdutide in Germany and the United States?

Duitsland: Cagrilintide — Niet goedgekeurd, Mazdutide — Alleen onderzoek. Verenigde Staten: Cagrilintide — Niet goedgekeurd, Mazdutide — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.