Confronto

Eloralintide vs. Exenatide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

nessun dato

141758-74-9

Peso molecolare

nessun dato

4186.6 g/mol

Emivita

nessun dato

2.4 h

Sequenza

nessun dato

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Meccanismo d'azione

Eloralintide

Eloralintide selectively activates amylin receptors (preferentially AMY1R) and promotes satiety. The approach targets weight loss via the amylin axis, complementary to or independent of GLP-1 agents.

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Eloralintide	Exenatide
Germania	Non approvato	Su prescrizione
Stati Uniti	Non approvato	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Eloralintide and Exenatide?: Eloralintide is classified as "Metabolico", while Exenatide is classified as "Metabolico". Eloralintide: Eloralintide is a selective, long-acting amylin receptor agonist from Eli Lilly for once-weekly subcutaneous use — under investigation for obesity, alone and combined with incretin therapy. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Eloralintide or Exenatide?: The highest available evidence level is "RCT sull'uomo" for Eloralintide and "RCT sull'uomo" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Eloralintide and Exenatide in Germany and the United States?: Germania: Eloralintide — Non approvato, Exenatide — Su prescrizione. Stati Uniti: Eloralintide — Non approvato, Exenatide — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Eloralintide

Exenatide

Germania

Non approvato

Su prescrizione

Stati Uniti

Non approvato

Su prescrizione

Frequently asked questions

What is the difference between Eloralintide and Exenatide?

Eloralintide is classified as "Metabolico", while Exenatide is classified as "Metabolico". Eloralintide: Eloralintide is a selective, long-acting amylin receptor agonist from Eli Lilly for once-weekly subcutaneous use — under investigation for obesity, alone and combined with incretin therapy. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Eloralintide or Exenatide?

The highest available evidence level is "RCT sull'uomo" for Eloralintide and "RCT sull'uomo" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Eloralintide and Exenatide in Germany and the United States?

Germania: Eloralintide — Non approvato, Exenatide — Su prescrizione. Stati Uniti: Eloralintide — Non approvato, Exenatide — Su prescrizione. These are factual summaries with source and review date on the individual pages.