Vergelijking

Eloralintide vs. Exenatide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

geen gegevens

141758-74-9

Molecuulmassa

geen gegevens

4186.6 g/mol

Halfwaardetijd

geen gegevens

2.4 h

Sequentie

geen gegevens

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Werkingsmechanisme

Eloralintide

Eloralintide selectively activates amylin receptors (preferentially AMY1R) and promotes satiety. The approach targets weight loss via the amylin axis, complementary to or independent of GLP-1 agents.

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Eloralintide	Exenatide
Duitsland	Niet goedgekeurd	Op recept
Verenigde Staten	Niet goedgekeurd	Op recept

Volledige vermeldingen

Eloralintide

Volledige vermelding →

Exenatide

Volledige vermelding →

Frequently asked questions

What is the difference between Eloralintide and Exenatide?: Eloralintide is classified as "Metabool", while Exenatide is classified as "Metabool". Eloralintide: Eloralintide is a selective, long-acting amylin receptor agonist from Eli Lilly for once-weekly subcutaneous use — under investigation for obesity, alone and combined with incretin therapy. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Eloralintide or Exenatide?: The highest available evidence level is "Humane RCT" for Eloralintide and "Humane RCT" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Eloralintide and Exenatide in Germany and the United States?: Duitsland: Eloralintide — Niet goedgekeurd, Exenatide — Op recept. Verenigde Staten: Eloralintide — Niet goedgekeurd, Exenatide — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Eloralintide

Exenatide

Duitsland

Niet goedgekeurd

Op recept

Verenigde Staten

Niet goedgekeurd

Op recept

Frequently asked questions

What is the difference between Eloralintide and Exenatide?

Eloralintide is classified as "Metabool", while Exenatide is classified as "Metabool". Eloralintide: Eloralintide is a selective, long-acting amylin receptor agonist from Eli Lilly for once-weekly subcutaneous use — under investigation for obesity, alone and combined with incretin therapy. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Eloralintide or Exenatide?

The highest available evidence level is "Humane RCT" for Eloralintide and "Humane RCT" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Eloralintide and Exenatide in Germany and the United States?

Duitsland: Eloralintide — Niet goedgekeurd, Exenatide — Op recept. Verenigde Staten: Eloralintide — Niet goedgekeurd, Exenatide — Op recept. These are factual summaries with source and review date on the individual pages.