Confronto

Exenatide vs. Pemvidutide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

141758-74-9

nessun dato

Peso molecolare

4186.6 g/mol

nessun dato

Emivita

2.4 h

nessun dato

Sequenza

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

nessun dato

Meccanismo d'azione

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Pemvidutide

The GLP-1 component suppresses appetite while the glucagon component raises energy expenditure and acts directly on hepatic fat metabolism — the combination is intended to mimic the complementary effects of diet and exercise.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Exenatide	Pemvidutide
Germania	Su prescrizione	Non approvato
Stati Uniti	Su prescrizione	Non approvato

Voci complete

Frequently asked questions

What is the difference between Exenatide and Pemvidutide?: Exenatide is classified as "Metabolico", while Pemvidutide is classified as "Metabolico". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Pemvidutide: Pemvidutide is a 29-amino-acid GLP-1/glucagon dual receptor agonist (Altimmune) under investigation for obesity and the fatty-liver disease MASH. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Pemvidutide?: The highest available evidence level is "RCT sull'uomo" for Exenatide and "Studio sull'uomo" for Pemvidutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Pemvidutide in Germany and the United States?: Germania: Exenatide — Su prescrizione, Pemvidutide — Non approvato. Stati Uniti: Exenatide — Su prescrizione, Pemvidutide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Pemvidutide

Germania

Su prescrizione

Non approvato

Stati Uniti

Su prescrizione

Non approvato

Frequently asked questions

What is the difference between Exenatide and Pemvidutide?

Exenatide is classified as "Metabolico", while Pemvidutide is classified as "Metabolico". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Pemvidutide: Pemvidutide is a 29-amino-acid GLP-1/glucagon dual receptor agonist (Altimmune) under investigation for obesity and the fatty-liver disease MASH. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Pemvidutide?

The highest available evidence level is "RCT sull'uomo" for Exenatide and "Studio sull'uomo" for Pemvidutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Pemvidutide in Germany and the United States?

Germania: Exenatide — Su prescrizione, Pemvidutide — Non approvato. Stati Uniti: Exenatide — Su prescrizione, Pemvidutide — Non approvato. These are factual summaries with source and review date on the individual pages.