Confronto

Exenatide vs. Pramlintid

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

141758-74-9

151126-32-8

Peso molecolare

4186.6 g/mol

3949.4 g/mol

Emivita

2.4 h

nessun dato

Sequenza

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

nessun dato

Meccanismo d'azione

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Pramlintid

Pramlintide mimics the beta-cell hormone amylin, which is co-secreted with insulin. It slows gastric emptying, suppresses postprandial glucagon release and promotes satiety — thereby blunting post-meal blood-glucose spikes.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Exenatide	Pramlintid
Germania	Su prescrizione	Non approvato
Stati Uniti	Su prescrizione	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Exenatide and Pramlintid?: Exenatide is classified as "Metabolico", while Pramlintid is classified as "Metabolico". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Pramlintid?: The highest available evidence level is "RCT sull'uomo" for Exenatide and "RCT sull'uomo" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Pramlintid in Germany and the United States?: Germania: Exenatide — Su prescrizione, Pramlintid — Non approvato. Stati Uniti: Exenatide — Su prescrizione, Pramlintid — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Pramlintid

Germania

Su prescrizione

Non approvato

Stati Uniti

Su prescrizione

Frequently asked questions

What is the difference between Exenatide and Pramlintid?

Exenatide is classified as "Metabolico", while Pramlintid is classified as "Metabolico". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Pramlintid?

The highest available evidence level is "RCT sull'uomo" for Exenatide and "RCT sull'uomo" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Pramlintid in Germany and the United States?

Germania: Exenatide — Su prescrizione, Pramlintid — Non approvato. Stati Uniti: Exenatide — Su prescrizione, Pramlintid — Su prescrizione. These are factual summaries with source and review date on the individual pages.