Vergelijking

Exenatide vs. Pramlintid

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

141758-74-9

151126-32-8

Molecuulmassa

4186.6 g/mol

3949.4 g/mol

Halfwaardetijd

2.4 h

geen gegevens

Sequentie

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

geen gegevens

Werkingsmechanisme

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Pramlintid

Pramlintide mimics the beta-cell hormone amylin, which is co-secreted with insulin. It slows gastric emptying, suppresses postprandial glucagon release and promotes satiety — thereby blunting post-meal blood-glucose spikes.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Exenatide	Pramlintid
Duitsland	Op recept	Niet goedgekeurd
Verenigde Staten	Op recept	Op recept

Volledige vermeldingen

Exenatide

Volledige vermelding →

Pramlintid

Volledige vermelding →

Frequently asked questions

What is the difference between Exenatide and Pramlintid?: Exenatide is classified as "Metabool", while Pramlintid is classified as "Metabool". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Pramlintid?: The highest available evidence level is "Humane RCT" for Exenatide and "Humane RCT" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Pramlintid in Germany and the United States?: Duitsland: Exenatide — Op recept, Pramlintid — Niet goedgekeurd. Verenigde Staten: Exenatide — Op recept, Pramlintid — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Pramlintid

Duitsland

Op recept

Niet goedgekeurd

Verenigde Staten

Op recept

Frequently asked questions

What is the difference between Exenatide and Pramlintid?

Exenatide is classified as "Metabool", while Pramlintid is classified as "Metabool". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Pramlintid?

The highest available evidence level is "Humane RCT" for Exenatide and "Humane RCT" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Pramlintid in Germany and the United States?

Duitsland: Exenatide — Op recept, Pramlintid — Niet goedgekeurd. Verenigde Staten: Exenatide — Op recept, Pramlintid — Op recept. These are factual summaries with source and review date on the individual pages.