Confronto

Exenatide vs. Semaglutid

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

141758-74-9

910463-68-2

Peso molecolare

4186.6 g/mol

4113.6 g/mol

Emivita

2.4 h

165 h

Sequenza

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

modifiziertes GLP-1-Analogon (31 AS) mit C18-Fettsäure-Linker

Meccanismo d'azione

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Semaglutid

Long-acting agonist at the GLP-1 receptor. Structurally a modified glucagon-like peptide 1 whose long half-life is achieved via a fatty-acid side chain and reversible albumin binding. Acts centrally on satiety and peripherally on glucose-dependent insulin secretion and delayed gastric emptying.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Exenatide	Semaglutid
Svizzera	—	Su prescrizione
Germania	Su prescrizione	Su prescrizione
Stati Uniti	Su prescrizione	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Exenatide and Semaglutid?: Exenatide is classified as "Metabolico", while Semaglutid is classified as "Metabolico". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Semaglutid?: The highest available evidence level is "RCT sull'uomo" for Exenatide and "RCT sull'uomo" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Semaglutid in Germany and the United States?: Germania: Exenatide — Su prescrizione, Semaglutid — Su prescrizione. Stati Uniti: Exenatide — Su prescrizione, Semaglutid — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Semaglutid

Svizzera

—

Su prescrizione

Germania

Su prescrizione

Stati Uniti

Su prescrizione

Frequently asked questions

What is the difference between Exenatide and Semaglutid?

Exenatide is classified as "Metabolico", while Semaglutid is classified as "Metabolico". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Semaglutid?

The highest available evidence level is "RCT sull'uomo" for Exenatide and "RCT sull'uomo" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Semaglutid in Germany and the United States?

Germania: Exenatide — Su prescrizione, Semaglutid — Su prescrizione. Stati Uniti: Exenatide — Su prescrizione, Semaglutid — Su prescrizione. These are factual summaries with source and review date on the individual pages.