Confronto

Liraglutide vs. Pramlintid

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

204656-20-2

151126-32-8

Peso molecolare

3751 g/mol

3949.4 g/mol

Emivita

13 h

nessun dato

Sequenza

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

nessun dato

Meccanismo d'azione

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Pramlintid

Pramlintide mimics the beta-cell hormone amylin, which is co-secreted with insulin. It slows gastric emptying, suppresses postprandial glucagon release and promotes satiety — thereby blunting post-meal blood-glucose spikes.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Liraglutide	Pramlintid
Germania	Su prescrizione	Non approvato
Stati Uniti	Su prescrizione	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Liraglutide and Pramlintid?: Liraglutide is classified as "Metabolico", while Pramlintid is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Pramlintid?: The highest available evidence level is "RCT sull'uomo" for Liraglutide and "RCT sull'uomo" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Pramlintid in Germany and the United States?: Germania: Liraglutide — Su prescrizione, Pramlintid — Non approvato. Stati Uniti: Liraglutide — Su prescrizione, Pramlintid — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Pramlintid

Germania

Su prescrizione

Non approvato

Stati Uniti

Su prescrizione

Frequently asked questions

What is the difference between Liraglutide and Pramlintid?

Liraglutide is classified as "Metabolico", while Pramlintid is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Pramlintid?

The highest available evidence level is "RCT sull'uomo" for Liraglutide and "RCT sull'uomo" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Pramlintid in Germany and the United States?

Germania: Liraglutide — Su prescrizione, Pramlintid — Non approvato. Stati Uniti: Liraglutide — Su prescrizione, Pramlintid — Su prescrizione. These are factual summaries with source and review date on the individual pages.