Vergelijking

Liraglutide vs. Pramlintid

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

204656-20-2

151126-32-8

Molecuulmassa

3751 g/mol

3949.4 g/mol

Halfwaardetijd

13 h

geen gegevens

Sequentie

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

geen gegevens

Werkingsmechanisme

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Pramlintid

Pramlintide mimics the beta-cell hormone amylin, which is co-secreted with insulin. It slows gastric emptying, suppresses postprandial glucagon release and promotes satiety — thereby blunting post-meal blood-glucose spikes.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Liraglutide	Pramlintid
Duitsland	Op recept	Niet goedgekeurd
Verenigde Staten	Op recept	Op recept

Volledige vermeldingen

Liraglutide

Volledige vermelding →

Pramlintid

Volledige vermelding →

Frequently asked questions

What is the difference between Liraglutide and Pramlintid?: Liraglutide is classified as "Metabool", while Pramlintid is classified as "Metabool". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Pramlintid?: The highest available evidence level is "Humane RCT" for Liraglutide and "Humane RCT" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Pramlintid in Germany and the United States?: Duitsland: Liraglutide — Op recept, Pramlintid — Niet goedgekeurd. Verenigde Staten: Liraglutide — Op recept, Pramlintid — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Pramlintid

Duitsland

Op recept

Niet goedgekeurd

Verenigde Staten

Op recept

Frequently asked questions

What is the difference between Liraglutide and Pramlintid?

Liraglutide is classified as "Metabool", while Pramlintid is classified as "Metabool". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Pramlintid?

The highest available evidence level is "Humane RCT" for Liraglutide and "Humane RCT" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Pramlintid in Germany and the United States?

Duitsland: Liraglutide — Op recept, Pramlintid — Niet goedgekeurd. Verenigde Staten: Liraglutide — Op recept, Pramlintid — Op recept. These are factual summaries with source and review date on the individual pages.