Vergelijking

Cagrilintide vs. Semaglutid

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

1415456-99-3

910463-68-2

Molecuulmassa

4253.7 g/mol

4113.6 g/mol

Halfwaardetijd

168 h

165 h

Sequentie

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

modifiziertes GLP-1-Analogon (31 AS) mit C18-Fettsäure-Linker

Werkingsmechanisme

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Semaglutid

Long-acting agonist at the GLP-1 receptor. Structurally a modified glucagon-like peptide 1 whose long half-life is achieved via a fatty-acid side chain and reversible albumin binding. Acts centrally on satiety and peripherally on glucose-dependent insulin secretion and delayed gastric emptying.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Cagrilintide	Semaglutid
Zwitserland	—	Op recept
Duitsland	Niet goedgekeurd	Op recept
DK	Niet goedgekeurd	—
Verenigde Staten	Niet goedgekeurd	Op recept

Volledige vermeldingen

Cagrilintide

Volledige vermelding →

Semaglutid

Volledige vermelding →

Frequently asked questions

What is the difference between Cagrilintide and Semaglutid?: Cagrilintide is classified as "Metabool", while Semaglutid is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Semaglutid?: The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Semaglutid in Germany and the United States?: Duitsland: Cagrilintide — Niet goedgekeurd, Semaglutid — Op recept. Verenigde Staten: Cagrilintide — Niet goedgekeurd, Semaglutid — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Semaglutid

Zwitserland

—

Op recept

Duitsland

Niet goedgekeurd

Op recept

Niet goedgekeurd

—

Verenigde Staten

Niet goedgekeurd

Op recept

Frequently asked questions

What is the difference between Cagrilintide and Semaglutid?

Cagrilintide is classified as "Metabool", while Semaglutid is classified as "Metabool". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Semaglutid?

The highest available evidence level is "Humane RCT" for Cagrilintide and "Humane RCT" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Semaglutid in Germany and the United States?

Duitsland: Cagrilintide — Niet goedgekeurd, Semaglutid — Op recept. Verenigde Staten: Cagrilintide — Niet goedgekeurd, Semaglutid — Op recept. These are factual summaries with source and review date on the individual pages.