Vergelijking

Enfuvirtid vs. LL-37

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Onderzoek (overig)

CAS-nr.

159519-65-0

597562-32-8

Molecuulmassa

4491.88 g/mol

4493.33 g/mol

Halfwaardetijd

geen gegevens

Sequentie

geen gegevens

[LL-37, 37 aa]

Werkingsmechanisme

Enfuvirtid

Enfuvirtide binds the first heptad-repeat region (HR1) of the gp41 subunit of the HIV envelope protein. This prevents the conformational change required for fusion of the viral and cell membranes — the virus cannot enter the cell.

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Bewijsbasis

Hoogste bewijs

Humane RCT

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Enfuvirtid	LL-37
Duitsland	Op recept	Alleen onderzoek
Verenigde Staten	Op recept	Alleen onderzoek

Volledige vermeldingen

Enfuvirtid

Volledige vermelding →

LL-37

Volledige vermelding →

Frequently asked questions

What is the difference between Enfuvirtid and LL-37?: Enfuvirtid is classified as "Onderzoek (overig)", while LL-37 is classified as "Onderzoek (overig)". Enfuvirtid: Enfuvirtide is a synthetic 36-amino-acid peptide and the first HIV-1 fusion inhibitor. It binds the HR1 region of the viral envelope protein gp41, blocking viral entry into the cell. Approved for treatment-experienced HIV patients. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Enfuvirtid or LL-37?: The highest available evidence level is "Humane RCT" for Enfuvirtid and "Humane studie" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Enfuvirtid and LL-37 in Germany and the United States?: Duitsland: Enfuvirtid — Op recept, LL-37 — Alleen onderzoek. Verenigde Staten: Enfuvirtid — Op recept, LL-37 — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.

Country

Enfuvirtid

LL-37

Duitsland

Op recept

Alleen onderzoek

Verenigde Staten

Op recept

Alleen onderzoek

Frequently asked questions

What is the difference between Enfuvirtid and LL-37?

Enfuvirtid is classified as "Onderzoek (overig)", while LL-37 is classified as "Onderzoek (overig)". Enfuvirtid: Enfuvirtide is a synthetic 36-amino-acid peptide and the first HIV-1 fusion inhibitor. It binds the HR1 region of the viral envelope protein gp41, blocking viral entry into the cell. Approved for treatment-experienced HIV patients. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Enfuvirtid or LL-37?

The highest available evidence level is "Humane RCT" for Enfuvirtid and "Humane studie" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Enfuvirtid and LL-37 in Germany and the United States?

Duitsland: Enfuvirtid — Op recept, LL-37 — Alleen onderzoek. Verenigde Staten: Enfuvirtid — Op recept, LL-37 — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.