Vergelijking

Exenatide vs. Petrelintide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

141758-74-9

geen gegevens

Molecuulmassa

4186.6 g/mol

geen gegevens

Halfwaardetijd

2.4 h

geen gegevens

Sequentie

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

geen gegevens

Werkingsmechanisme

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Petrelintide

As an amylin analogue, petrelintide acts through amylin receptors, promoting satiety and slowed gastric emptying — a satiety pathway independent of the GLP-1 axis.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Exenatide	Petrelintide
Duitsland	Op recept	Niet goedgekeurd
Verenigde Staten	Op recept	Niet goedgekeurd

Volledige vermeldingen

Exenatide

Volledige vermelding →

Petrelintide

Volledige vermelding →

Frequently asked questions

What is the difference between Exenatide and Petrelintide?: Exenatide is classified as "Metabool", while Petrelintide is classified as "Metabool". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or Petrelintide?: The highest available evidence level is "Humane RCT" for Exenatide and "Humane RCT" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and Petrelintide in Germany and the United States?: Duitsland: Exenatide — Op recept, Petrelintide — Niet goedgekeurd. Verenigde Staten: Exenatide — Op recept, Petrelintide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

Petrelintide

Duitsland

Op recept

Niet goedgekeurd

Verenigde Staten

Op recept

Niet goedgekeurd

Frequently asked questions

What is the difference between Exenatide and Petrelintide?

Exenatide is classified as "Metabool", while Petrelintide is classified as "Metabool". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or Petrelintide?

The highest available evidence level is "Humane RCT" for Exenatide and "Humane RCT" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and Petrelintide in Germany and the United States?

Duitsland: Exenatide — Op recept, Petrelintide — Niet goedgekeurd. Verenigde Staten: Exenatide — Op recept, Petrelintide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.