Сравнение

CJC-1295 vs. Hexarelin

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Рост

Номер CAS

нет данных

140703-51-1

Молекулярная масса

3647.3 g/mol

887.05 g/mol

Период полувыведения

144 h

0.9 h

Последовательность

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2

Механизм действия

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Hexarelin

Hexarelin is a synthetic analog of the GHRP-6 family binding both the GH secretagogue receptor (GHSR-1a) and CD36. GHSR activation in the pituitary releases pulsatile growth hormone. Via CD36 in endothelium and myocardium, cardioprotective effects have been described in animal studies.

Доказательная база

Наивысшая доказательность

Исследование на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	CJC-1295	Hexarelin
Австралия	—	Запрещено
Германия	Не одобрено	Не одобрено
США	Только для исследований	Не одобрено

Полные записи

Frequently asked questions

What is the difference between CJC-1295 and Hexarelin?: CJC-1295 is classified as "Рост", while Hexarelin is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Hexarelin: Synthetic hexapeptide of the growth-hormone secretagogue (GHRP) family. In the 1990s investigated as an acromegaly diagnostic and for GH deficiency. Not an approved medicine. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Hexarelin?: The highest available evidence level is "Исследование на людях" for CJC-1295 and "Исследование на людях" for Hexarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Hexarelin in Germany and the United States?: Германия: CJC-1295 — Не одобрено, Hexarelin — Не одобрено. США: CJC-1295 — Только для исследований, Hexarelin — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Hexarelin

Австралия

—

Запрещено

Германия

Не одобрено

США

Только для исследований

Не одобрено

Frequently asked questions

What is the difference between CJC-1295 and Hexarelin?

CJC-1295 is classified as "Рост", while Hexarelin is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Hexarelin: Synthetic hexapeptide of the growth-hormone secretagogue (GHRP) family. In the 1990s investigated as an acromegaly diagnostic and for GH deficiency. Not an approved medicine. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Hexarelin?

The highest available evidence level is "Исследование на людях" for CJC-1295 and "Исследование на людях" for Hexarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Hexarelin in Germany and the United States?

Германия: CJC-1295 — Не одобрено, Hexarelin — Не одобрено. США: CJC-1295 — Только для исследований, Hexarelin — Не одобрено. These are factual summaries with source and review date on the individual pages.