Confronto

CJC-1295 vs. Hexarelin

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Crescita

N. CAS

nessun dato

140703-51-1

Peso molecolare

3647.3 g/mol

887.05 g/mol

Emivita

144 h

0.9 h

Sequenza

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2

Meccanismo d'azione

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Hexarelin

Hexarelin is a synthetic analog of the GHRP-6 family binding both the GH secretagogue receptor (GHSR-1a) and CD36. GHSR activation in the pituitary releases pulsatile growth hormone. Via CD36 in endothelium and myocardium, cardioprotective effects have been described in animal studies.

Base di evidenze

Evidenza più alta

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	CJC-1295	Hexarelin
Australia	—	Vietato
Germania	Non approvato	Non approvato
Stati Uniti	Solo ricerca	Non approvato

Voci complete

Frequently asked questions

What is the difference between CJC-1295 and Hexarelin?: CJC-1295 is classified as "Crescita", while Hexarelin is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Hexarelin: Synthetic hexapeptide of the growth-hormone secretagogue (GHRP) family. In the 1990s investigated as an acromegaly diagnostic and for GH deficiency. Not an approved medicine. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Hexarelin?: The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "Studio sull'uomo" for Hexarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Hexarelin in Germany and the United States?: Germania: CJC-1295 — Non approvato, Hexarelin — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, Hexarelin — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Hexarelin

Australia

—

Vietato

Germania

Non approvato

Stati Uniti

Solo ricerca

Non approvato

Frequently asked questions

What is the difference between CJC-1295 and Hexarelin?

CJC-1295 is classified as "Crescita", while Hexarelin is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Hexarelin: Synthetic hexapeptide of the growth-hormone secretagogue (GHRP) family. In the 1990s investigated as an acromegaly diagnostic and for GH deficiency. Not an approved medicine. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Hexarelin?

The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "Studio sull'uomo" for Hexarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Hexarelin in Germany and the United States?

Germania: CJC-1295 — Non approvato, Hexarelin — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, Hexarelin — Non approvato. These are factual summaries with source and review date on the individual pages.