Vergelijking

CJC-1295 vs. Hexarelin

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Groei

CAS-nr.

geen gegevens

140703-51-1

Molecuulmassa

3647.3 g/mol

887.05 g/mol

Halfwaardetijd

144 h

0.9 h

Sequentie

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2

Werkingsmechanisme

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Hexarelin

Hexarelin is a synthetic analog of the GHRP-6 family binding both the GH secretagogue receptor (GHSR-1a) and CD36. GHSR activation in the pituitary releases pulsatile growth hormone. Via CD36 in endothelium and myocardium, cardioprotective effects have been described in animal studies.

Bewijsbasis

Hoogste bewijs

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	CJC-1295	Hexarelin
Australië	—	Verboden
Duitsland	Niet goedgekeurd	Niet goedgekeurd
Verenigde Staten	Alleen onderzoek	Niet goedgekeurd

Volledige vermeldingen

CJC-1295

Volledige vermelding →

Hexarelin

Volledige vermelding →

Frequently asked questions

What is the difference between CJC-1295 and Hexarelin?: CJC-1295 is classified as "Groei", while Hexarelin is classified as "Groei". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Hexarelin: Synthetic hexapeptide of the growth-hormone secretagogue (GHRP) family. In the 1990s investigated as an acromegaly diagnostic and for GH deficiency. Not an approved medicine. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Hexarelin?: The highest available evidence level is "Humane studie" for CJC-1295 and "Humane studie" for Hexarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Hexarelin in Germany and the United States?: Duitsland: CJC-1295 — Niet goedgekeurd, Hexarelin — Niet goedgekeurd. Verenigde Staten: CJC-1295 — Alleen onderzoek, Hexarelin — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Hexarelin

Australië

—

Verboden

Duitsland

Niet goedgekeurd

Verenigde Staten

Alleen onderzoek

Niet goedgekeurd

Frequently asked questions

What is the difference between CJC-1295 and Hexarelin?

CJC-1295 is classified as "Groei", while Hexarelin is classified as "Groei". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Hexarelin: Synthetic hexapeptide of the growth-hormone secretagogue (GHRP) family. In the 1990s investigated as an acromegaly diagnostic and for GH deficiency. Not an approved medicine. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Hexarelin?

The highest available evidence level is "Humane studie" for CJC-1295 and "Humane studie" for Hexarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Hexarelin in Germany and the United States?

Duitsland: CJC-1295 — Niet goedgekeurd, Hexarelin — Niet goedgekeurd. Verenigde Staten: CJC-1295 — Alleen onderzoek, Hexarelin — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.