Confronto

Cagrilintide vs. Pramlintid

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

1415456-99-3

151126-32-8

Peso molecolare

4253.7 g/mol

3949.4 g/mol

Emivita

168 h

nessun dato

Sequenza

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

nessun dato

Meccanismo d'azione

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Pramlintid

Pramlintide mimics the beta-cell hormone amylin, which is co-secreted with insulin. It slows gastric emptying, suppresses postprandial glucagon release and promotes satiety — thereby blunting post-meal blood-glucose spikes.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Cagrilintide	Pramlintid
Germania	Non approvato	Non approvato
DK	Non approvato	—
Stati Uniti	Non approvato	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Cagrilintide and Pramlintid?: Cagrilintide is classified as "Metabolico", while Pramlintid is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Pramlintid?: The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Pramlintid in Germany and the United States?: Germania: Cagrilintide — Non approvato, Pramlintid — Non approvato. Stati Uniti: Cagrilintide — Non approvato, Pramlintid — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Pramlintid

Germania

Non approvato

—

Stati Uniti

Non approvato

Su prescrizione

Frequently asked questions

What is the difference between Cagrilintide and Pramlintid?

Cagrilintide is classified as "Metabolico", while Pramlintid is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Pramlintid: Pramlintide is a synthetic analog of the hormone amylin. It is used as an adjunct to mealtime insulin therapy in type 1 and type 2 diabetes and, among other things, slows gastric emptying. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Pramlintid?

The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Pramlintid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Pramlintid in Germany and the United States?

Germania: Cagrilintide — Non approvato, Pramlintid — Non approvato. Stati Uniti: Cagrilintide — Non approvato, Pramlintid — Su prescrizione. These are factual summaries with source and review date on the individual pages.