Confronto

Tirzepatide vs. VK2735

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

2023788-19-2

nessun dato

Peso molecolare

4813 g/mol

nessun dato

Emivita

116 h

nessun dato

Sequenza

YXEGTFTSDYSIYLDKIAQKAFVQWLIAGGPSSGAPPPS

nessun dato

Meccanismo d'azione

Tirzepatide

Tirzepatide is a 39-amino-acid peptide acting as a dual agonist at the GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide) receptors. Activation of both incretin receptors via G-protein-coupled signalling raises insulin secretion in a glucose-dependent manner, lowers glucagon secretion and delays gastric emptying. Centrally, satiety perception is modulated. A fatty-acid side chain binds to serum albumin and extends the half-life to about five days.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Tirzepatide	VK2735
Svizzera	Su prescrizione	—
Germania	Su prescrizione	Non approvato
Stati Uniti	Su prescrizione	Non approvato

Voci complete

Frequently asked questions

What is the difference between Tirzepatide and VK2735?: Tirzepatide is classified as "Metabolico", while VK2735 is classified as "Metabolico". Tirzepatide: Synthetic peptide that simultaneously activates the GLP-1 and GIP receptor (dual agonist). Approved in the US and EU for type 2 diabetes (Mounjaro) and obesity (Zepbound). VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Tirzepatide or VK2735?: The highest available evidence level is "RCT sull'uomo" for Tirzepatide and "RCT sull'uomo" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Tirzepatide and VK2735 in Germany and the United States?: Germania: Tirzepatide — Su prescrizione, VK2735 — Non approvato. Stati Uniti: Tirzepatide — Su prescrizione, VK2735 — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Tirzepatide

VK2735

Svizzera

Su prescrizione

—

Germania

Su prescrizione

Non approvato

Stati Uniti

Su prescrizione

Non approvato

Frequently asked questions

What is the difference between Tirzepatide and VK2735?

Tirzepatide is classified as "Metabolico", while VK2735 is classified as "Metabolico". Tirzepatide: Synthetic peptide that simultaneously activates the GLP-1 and GIP receptor (dual agonist). Approved in the US and EU for type 2 diabetes (Mounjaro) and obesity (Zepbound). VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Tirzepatide or VK2735?

The highest available evidence level is "RCT sull'uomo" for Tirzepatide and "RCT sull'uomo" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Tirzepatide and VK2735 in Germany and the United States?

Germania: Tirzepatide — Su prescrizione, VK2735 — Non approvato. Stati Uniti: Tirzepatide — Su prescrizione, VK2735 — Non approvato. These are factual summaries with source and review date on the individual pages.