Confronto

Cagrilintide vs. Exenatide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

1415456-99-3

141758-74-9

Peso molecolare

4253.7 g/mol

4186.6 g/mol

Emivita

168 h

2.4 h

Sequenza

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Meccanismo d'azione

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Cagrilintide	Exenatide
Germania	Non approvato	Su prescrizione
DK	Non approvato	—
Stati Uniti	Non approvato	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Cagrilintide and Exenatide?: Cagrilintide is classified as "Metabolico", while Exenatide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Exenatide?: The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Exenatide in Germany and the United States?: Germania: Cagrilintide — Non approvato, Exenatide — Su prescrizione. Stati Uniti: Cagrilintide — Non approvato, Exenatide — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Exenatide

Germania

Non approvato

Su prescrizione

Non approvato

—

Stati Uniti

Non approvato

Su prescrizione

Frequently asked questions

What is the difference between Cagrilintide and Exenatide?

Cagrilintide is classified as "Metabolico", while Exenatide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Exenatide?

The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Exenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Exenatide in Germany and the United States?

Germania: Cagrilintide — Non approvato, Exenatide — Su prescrizione. Stati Uniti: Cagrilintide — Non approvato, Exenatide — Su prescrizione. These are factual summaries with source and review date on the individual pages.