Comparison
Abaloparatid vs. FOXO4-DRI
Two peptides side-by-side — identity, evidence base, legal status and known adverse events.
Identity
Category
Research other
Research other
CAS no.
247062-33-5
2074706-72-8
Molecular weight
3960.6 g/mol
3735 g/mol
Half-life
1.7 h
0.5 h
Sequence
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Glu-Leu-Leu-Glu-Lys-Leu-Leu-Aib-Lys-Leu-His-Thr-Ala-NH2D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Mechanism of action
Abaloparatid
Abaloparatide is a synthetic analogue of the first 34 amino acids of parathyroid hormone-related protein (PTHrP). Like parathyroid hormone and teriparatide it binds the PTH-1 receptor, but the literature describes it as preferentially engaging the so-called RG conformation of the receptor, which is associated with shorter signaling duration. As for the entire drug class, intermittent receptor activation is regarded as the mechanistic basis for the stimulation of bone-forming osteoblasts observed in studies, whereas continuously elevated exposure would tend to favor bone resorption. From this binding behavior the literature derives a discussed balance between bone formation and bone resorption.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Evidence base
Highest evidence
Human RCT
Animal model
Studies
4
3
of which in humans
4
0
Effects recorded
4
3
Open conflicts
1
1
Documented adverse events
2
1
Legal status
Full entries
Frequently asked questions
- What is the difference between Abaloparatid and FOXO4-DRI?
- Abaloparatid is classified as "Research other", while FOXO4-DRI is classified as "Research other". Abaloparatid: Abaloparatide is a synthetic 34-amino-acid analogue of parathyroid hormone-related protein (PTHrP 1-34). It is regulatory-approved and studied in the scientific literature as a bone-anabolic agent for the treatment of osteoporosis in postmenopausal women at high fracture risk. Like the related teriparatide, studies describe it as stimulating new bone formation, but it exhibits a distinct receptor-binding profile. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Abaloparatid or FOXO4-DRI?
- The highest available evidence level is "Human RCT" for Abaloparatid and "Animal model" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Abaloparatid and FOXO4-DRI in Germany and the United States?
- Germany: Abaloparatid — Prescription, FOXO4-DRI — Research only. United States: Abaloparatid — Prescription, FOXO4-DRI — Research only. These are factual summaries with source and review date on the individual pages.